Informations

Est-il difficile de renaturer une protéine ?

Est-il difficile de renaturer une protéine ?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Je connais les expériences d'Anfinsen et je suis conscient que certaines enzymes dénaturées peuvent retrouver leur activité perdue grâce à l'élimination de l'agent dénaturant. Ce que j'ignore, c'est à quel point est-il rare qu'une protéine puisse se renaturer ? Est-ce que toutes les protéines peuvent faire ça ? Si tous ne peuvent pas le faire, à quel point est-il rare ou courant de trouver une protéine qui peut être renaturée ?

P.S. Pour éviter des réponses telles que « dépend de votre processus de dénaturation », supposons qu'une protéine peut être renaturée s'il a été démontré qu'elle se renature dans au moins une configuration expérimentale.


La réponse ressemble plus à « Cela dépend de la protéine et du processus de renaturation (ou de repliement) ». De nombreux facteurs contribuent à la capacité d'une protéine individuelle à se replier, notamment la taille, la séquence, la structure secondaire, la quantité et le type de liaisons inter-acides aminés telles que les liaisons disulfure, le nombre de sous-unités, la présence de chaperons/protéines de choc thermique, et, oui, comment il a été dénaturé en premier lieu (désolé, je n'ai pas pu résister). Les petites protéines se replieront plus facilement que les plus grosses. Les protéines hydrophiles ont tendance à mieux se replier que les protéines plus hydrophobes, en particulier les protéines liées à la membrane. Les protéines/complexes multi-sous-unités ont tendance à avoir besoin d'aide pour se réassembler correctement. L'ajout de chaperons/protéines de choc thermique aidera presque certainement le processus pour tous les échantillons sauf les plus petits et les plus résistants, et vous donnera de meilleurs résultats que la simple dialyse de tous les sels/détergents/agents chaotropes dans du PBS. Enfin, si vous dénaturez en faisant bouillir dans du tampon Laemmli, vous allez avoir beaucoup de mal à replier la plupart des choses, alors que passer de la Guanidine HCl au PBS n'est pas toujours si mal, selon ce que vous regardez.

Donc, malheureusement, la réponse est "ça dépend". Vous devez vous rappeler que l'environnement intracellulaire est très complexe et est conçu pour replier correctement les protéines après leur fabrication et pour décomposer les protéines mal repliées avant qu'elles ne puissent s'agréger ou causer d'autres dommages. Il existe des centaines de milliers de protéines uniquement chez l'homme, il est donc assez difficile de faire des déclarations générales, mais pour des raisons de résistance aux dommages, de nombreuses protéines plus petites et à sous-unité unique peuvent probablement être au moins partiellement à en grande partie repliées et regagner une partie ou toute leur activité d'origine. Cependant, à mesure que la complexité augmente, la probabilité de récupérer avec succès la fonction diminue.


Si la protéine est soumise à des changements de température, de pH ou d'exposition à des produits chimiques, les interactions internes entre les acides aminés de la protéine peuvent être altérées, ce qui peut à son tour altérer la forme de la protéine. Bien que la séquence d'acides aminés (également connue sous le nom de structure primaire de la protéine) ne change pas, la forme de la protéine peut tellement changer qu'elle devient dysfonctionnelle, auquel cas la protéine est considérée comme dénaturée. La pepsine, l'enzyme qui décompose les protéines dans l'estomac, n'agit qu'à un pH très bas. À des pH plus élevés, la conformation de la pepsine, la façon dont sa chaîne polypeptidique est repliée en trois dimensions, commence à changer. L'estomac maintient un pH très bas pour garantir que la pepsine continue de digérer les protéines et ne se dénature pas.

Parce que presque toutes les réactions biochimiques nécessitent des enzymes, et parce que presque toutes les enzymes ne fonctionnent de manière optimale que dans des plages de température et de pH relativement étroites, de nombreux mécanismes homéostatiques régulent les températures et le pH appropriés afin que les enzymes puissent maintenir la forme de leur site actif.


Présentation de la lyse cellulaire et de l'extraction de protéines

Toutes les cellules ont une membrane plasmique, une bicouche protéine-lipide qui forme une barrière séparant le contenu cellulaire de l'environnement extracellulaire. Les lipides comprenant la membrane plasmique sont amphipathiques, ayant des fragments hydrophiles et hydrophobes qui s'associent spontanément pour former une feuille bimoléculaire fermée. Les protéines membranaires sont intégrées dans la bicouche lipidique, maintenues en place par un ou plusieurs domaines couvrant le noyau hydrophobe. De plus, les protéines périphériques se lient à la surface interne ou externe de la bicouche par le biais d'interactions avec des protéines membranaires intégrales ou avec des groupes de tête lipidique polaire. La nature de la teneur en lipides et en protéines varie selon le type de cellule et l'espèce d'organisme.

Structure de la membrane cellulaire. Illustration d'une bicouche lipidique comprenant la membrane plasmique externe d'une cellule.

Dans les cellules animales, la membrane plasmique est la seule barrière séparant le contenu cellulaire de l'environnement, mais dans les plantes et les bactéries, la membrane plasmique est également entourée d'une paroi cellulaire rigide. Les parois cellulaires bactériennes sont composées de peptidoglycane. Les parois cellulaires de la levure sont composées de deux couches de -glucane, la couche interne étant insoluble dans des conditions alcalines. Les deux sont entourés d'une couche externe de glycoprotéines riches en hydrate de carbone mannane. Les parois cellulaires végétales sont constituées de plusieurs couches de cellulose. Ces types de barrières extracellulaires confèrent forme et rigidité aux cellules. Les parois cellulaires végétales sont particulièrement résistantes, ce qui les rend très difficiles à rompre mécaniquement ou chimiquement. Jusqu'à récemment, une lyse efficace des cellules de levure nécessitait une rupture mécanique à l'aide de billes de verre, alors que les parois cellulaires bactériennes sont les plus faciles à briser par rapport à ces autres types de cellules. L'absence de paroi extracellulaire dans les cellules animales les rend relativement faciles à lyser.

Il n'existe pas de protocole universel pour la préparation d'échantillons de protéines. Les protocoles de préparation des échantillons doivent prendre en compte plusieurs facteurs, tels que la source de l'échantillon ou le type d'échantillon, l'hétérogénéité chimique et structurelle des protéines, l'emplacement cellulaire ou subcellulaire de la protéine d'intérêt, le rendement protéique requis (qui dépend de la applications) et les applications en aval proposées. Par exemple, les fluides corporels tels que l'urine ou le plasma sont déjà des solutions de protéines plus ou moins homogènes avec une faible activité enzymatique, et seule une manipulation mineure est nécessaire pour obtenir des protéines à partir de ces échantillons. Les échantillons de tissus, cependant, nécessitent une manipulation approfondie pour briser l'architecture tissulaire, contrôler l'activité enzymatique et solubiliser les protéines.

La qualité ou la forme physique de la protéine isolée est également une considération importante lors de l'extraction de protéines pour certaines applications en aval. Par exemple, des applications telles que le dosage immuno-enzymatique fonctionnel (ELISA) ou la cristallographie nécessitent non seulement des protéines intactes, mais également des protéines fonctionnellement actives ou qui conservent leur structure 3D.

Exemples de sources de protéines pour la collecte d'échantillons. Les protéines peuvent provenir de nombreuses sources, y compris les suivantes : sources natives telles que cultures de cellules de mammifères, tissus ou fluides corporels surexpression dans un système modèle tel que bactéries, levures, cellules d'insectes ou de mammifères anticorps monoclonaux provenant de cellules d'hybridomes ou de cellules végétales utilisées en biotechnologie agricole .


Analyse cryo-EM d'une protéine membranaire incluse dans le liposome

Les protéines membranaires (MP) étaient les cibles les plus difficiles pour la biologie structurale lorsque la cristallographie aux rayons X était l'approche dominante. Avec la révolution de la résolution de la cryo-microscopie électronique à particule unique (cryo-EM), des progrès rapides ont été réalisés pour l'élucidation structurelle des MP isolées. Le prochain défi est de préserver les gradients électrochimiques et la courbure de la membrane pour une élucidation structurelle complète des MP qui reposent sur ces propriétés chimiques et physiques pour leurs fonctions biologiques. Vers cet objectif, nous présentons ici un flux de travail pratique pour l'analyse structurelle cryo-EM des MP intégrées dans des liposomes, en utilisant l'AcrB bien caractérisé comme prototype. Combinant l'isolement optimisé des protéoliposomes, la préparation d'échantillons cryogéniques sur des grilles de graphène et une stratégie de sélection de particules efficace, la reconstruction tridimensionnelle (3D) d'AcrB intégrée dans des liposomes a été obtenue à une résolution de 3,9 Å. La conformation de l'AcrB homotrimérique reste la même lorsque les membranes environnantes présentent des courbures différentes. Notre approche, qui peut être largement appliquée à l'analyse cryo-EM des MP avec des domaines solubles distinctifs, pose les bases de l'analyse cryo-EM des MP intégrales ou périphériques dont les fonctions sont affectées par des gradients électrochimiques transmembranaires ou/et des courbures membranaires.

Mots clés: cryo-EM graphène grilles protéine membranaire protéoliposome biologie structurale.

Déclaration de conflit d'intérêts

Les auteurs ne déclarent aucun intérêt concurrent.

Les figures

Optimisation de la préparation des cryo-échantillons de protéoliposomes.…

Optimisation de la préparation des cryo-échantillons de protéoliposomes. ( UNE ) Une illustration schématique de la taille…

Classification 2D profonde pour la sélection…

Classification 2D approfondie pour la sélection de bonnes particules de protéines intégrées dans les liposomes. Protéine…

Reconstruction monoparticule d'AcrB embarqué…

Reconstruction monoparticulaire d'AcrB intégré dans des protéoliposomes. ( UNE ) Vue de dessus et…

AcrB entouré de différentes membranes…

AcrB entouré de différentes courbures membranaires présente une structure identique. ( UNE ) 2D…


Dialyse par étapes ? - (15 oct. 2009 )

J'ai besoin du protocole de dialyse par étapes, en détail, et quel est le rapport entre l'échantillon et le tampon dans ce type de dialyse ?

Comme il le suggère, il s'agit d'une réduction progressive de la concentration du composant que vous souhaitez supprimer. Pourquoi veux-tu le faire ? Vous avez beaucoup plus de chances d'obtenir une réponse rapide si vous nous donnez plus d'informations que moins.

swanny le 18 octobre 2009, 19h00 à 19h00 a dit :

Je dois le faire après avoir extrait la protéine des corps d'inclusion, et maintenant ma protéine est solubilisée dans de l'urée 8M.
le problème c'est que j'ai le principe du protocole mais je ne sais pas comment le faire correctement.
voici le protocole :


((le culot a été remis en suspension dans 5 ml d'urée 8 M dans du PBS, centrifugé comme précédemment et le surnageant retenu. La protéine solubilisée dans l'urée a été diluée à 0,2 mg> ml avec 8 Murea dans du PBS et l'urée éliminée par dialyse progressive contre 20 volumes de tampon A contenant 4 M, 2 M, 1 M d'urée, puis trois changements de tampon sans urée. Chaque étape de dialyse a duré un minimum de 2 h. L'échantillon a été clarifié par centrifugation à 70000 g pendant 30 min à 4 °C et dialysé
contre tampon A contenant 50 % de glycérol pendant 24 h et conservé à 20 °C.)))

Ce détail est génial. OK, 20 vols de tampon équivaut à 20 fois votre volume d'échantillon. constituer le premier tampon avec de l'urée 4M et y dialyse pendant > 2 h. Transférer ensuite le tube de dialyse dans le deuxième tampon, composé d'urée 2 M et ainsi de suite. La meilleure façon de le faire est de préparer le tampon sans urée sous forme de solution 2x (50 mM Tris, 20% glycérol, etc.). Ajoutez ensuite un volume égal d'urée 8M pour faire le premier tampon (4M). Ajoutez 1/4 de volume d'urée et 1/4 de volume d'eau à 1/2 volume de stock tampon pour fabriquer le tampon d'urée 2M, etc. baisse de concentration.

Une autre façon d'éliminer l'urée est d'avoir un grand volume de tampon sous agitation dans un bécher. Ajouter la protéine dénaturée goutte à goutte dans le tampon. Cela diluera rapidement l'urée tout en réduisant le risque de protéines : interactions protéiques qui pourraient conduire à l'agrégation.

Si vous rencontrez toujours des problèmes, rendez-vous sur http://refold.med.monash.edu.au/ . C'est un site Web dédié au repliement des protéines dénaturées, vous êtes donc presque sûr de trouver quelque chose d'utile.

swanny le 19 octobre 2009, 17h00 et 17h00 a dit :

Ce détail est génial. OK, 20 vols de tampon équivaut à 20 fois votre volume d'échantillon. constituer le premier tampon avec de l'urée 4M et y dialyse pendant > 2 h. Transférer ensuite le tube de dialyse dans le deuxième tampon, composé d'urée 2 M et ainsi de suite. La meilleure façon de le faire est de préparer le tampon sans urée sous forme de solution 2x (50 mM Tris, 20% glycérol, etc.). Ajoutez ensuite un volume égal d'urée 8M pour faire le premier tampon (4M). Ajoutez 1/4 de volume d'urée et 1/4 de volume d'eau à 1/2 volume de stock tampon pour fabriquer le tampon d'urée 2M, etc. baisse de concentration.

Une autre façon d'éliminer l'urée est d'avoir un grand volume de tampon sous agitation dans un bécher. Ajouter la protéine dénaturée goutte à goutte dans le tampon. Cela diluera rapidement l'urée tout en réduisant le risque de protéines : interactions protéiques qui pourraient conduire à l'agrégation.

Si vous rencontrez toujours des problèmes, rendez-vous sur http://refold.med.monash.edu.au/ . C'est un site Web dédié au repliement des protéines dénaturées, vous êtes donc presque sûr de trouver quelque chose d'utile.

Description WOW plus que ce à quoi je m'attendais, vous avez tout décrit mieux que mon superviseur. Merci beaucoup Swanny, bonne journée.

juste une autre question pourriez-vous s'il vous plaît expliquer ce qui suit :
((Une autre façon d'éliminer l'urée est d'avoir un grand volume de tampon en remuant dans un bécher. Ajouter la protéine dénaturée goutte à goutte dans le tampon.))
Puis-je également stocker des protéines solublisées dans de l'urée 8M jusqu'à ce que le processus soit en -80 ?

Il ne devrait pas y avoir de problème. Après al, la protéine est déjà dépliée (le problème habituel lors de la congélation des protéines), et l'urée aura également dénaturé toutes les protéases qui pourraient traîner.

vous n'avez pas répondu à ma question, comment puis-je ajouter la protéine dénaturée goutte à goutte dans le tampon, pratiquement je n'ai aucune idée de ce type de dialyse?


2_puis-je également exécuter SDS à ce stade pour la protéine solublisée ou dois-je d'abord la replier ?

bluebird le 22 octobre 2009, 03ᚳ AM a dit :

mdfenko le 22 octobre 2009, à 10h00 du matin, a déclaré :

bluebird le 22 octobre 2009, 03ᚳ AM a dit :


même si la protéine est soluble dans l'urée 8M ? pensez-vous que la FDS donnera un bon résultat.


Types de détergents et sélection

Lors du choix d'un détergent, la première considération est généralement la forme du groupe hydrophile.

Sur la base de leur structure, les détergents peuvent être classés en gros comme : 3

Détergents ioniques

Les détergents ioniques contiennent des groupes de tête anioniques ou cationiques et possèdent une charge nette. Leurs queues hydrophobes sont soit des chaînes hydrocarbonées droites, comme dans le dodécyl sulfate de sodium (SDS) et le bromure de cétyltriméthylammonium (CTAB ), soit des groupes stéroïdiens rigides, comme dans les sels d'acides biliaires. 4 La taille d'une micelle de détergent ionique est déterminée par l'effet combiné de l'attraction hydrophobe des chaînes latérales et des forces de répulsion des groupes ioniques. Par conséquent, la neutralisation de la charge sur le groupe de tête avec des concentrations croissantes d'un contre-ion conduit à une plus grande taille micellaire. La taille micellaire augmente également avec l'augmentation de la longueur de la chaîne alkyle. Les détergents ioniques sont extrêmement efficaces dans la solubilisation des protéines membranaires mais sont presque toujours dénaturants dans une certaine mesure. 5

Sels d'acides biliaires sont des détergents anioniques avec des squelettes constitués de groupes stéroïdiens rigides, par exemple, des sels de sodium d'acide cholique et d'acide désoxycholique. Du fait de leur structure plane, ces molécules ont donc une face polaire et une face apolaire, leurs CMC sont élevées et leurs micelles sont petites, ce qui les rend faciles à éliminer par dialyse. 6 Les acides biliaires sont des détergents relativement doux et sont souvent moins désactivants que les détergents à chaîne linéaire avec le même groupe de tête. 7 Les monomères d'acides biliaires non conjugués ont des valeurs de pKa d'environ 5 à 6 et une solubilité limitée à de faibles valeurs de pH. Cependant, la conjugaison des acides biliaires réduit le pKa et conduit à une plus grande fraction de molécules ionisées à n'importe quel pH donné. Étant donné que la forme de sel ionisé est plus soluble dans l'eau que la forme acide protonée, la conjugaison améliore la solubilité à un pH faible. 8

Détergents non ioniques

Les détergents non ioniques contiennent des groupes de tête hydrophiles non chargés qui se composent soit de fragments polyoxyéthylène, comme dans les détergents BRIJ ® et TRITON™, soit de groupes glycosidiques, comme dans l'octyl glucoside et le dodécyl maltoside. Étant donné que les détergents non ioniques brisent les interactions lipide-lipide et lipide-protéine, mais pas les interactions protéine-protéine, ils sont considérés comme non dénaturants. 9 Ainsi, ils sont largement utilisés dans l'isolement de protéines membranaires sous leur forme biologiquement active. Contrairement aux détergents ioniques, les sels ont un effet minime sur la taille micellaire des détergents non ioniques. 5

Les détergents avec des groupes de tête polyoxyéthylène peuvent contenir des éthers d'alkylpolyéthylène de formule générale CnH2n+1(OCH2CH2)xOH, ou un cycle phényle entre la chaîne alkyle et le groupe éther. Le détergent TRITON™ X-100 appartient à cette dernière classe. Il convient de noter que les détergents contenant des cycles aromatiques absorbent dans la région ultraviolette. Ils peuvent interférer avec le contrôle spectrophotométrique des protéines à 280 nm. Des versions hydrogénées de ces détergents sont disponibles, dans lesquelles les anneaux aromatiques sont réduits pour éliminer l'absorption des UV. Cependant, de petites quantités de matière n'ayant pas réagi peuvent être présentes dans ces préparations réduites. En variante, des détergents polyoxyéthylénés disponibles dans le commerce avec des fragments hydrophobes aliphatiques peuvent remplacer certains polyoxyéthylènes aromatiques dans certaines applications. Par exemple, le TERGITOL™ 15-S-9, le TERGITOL™ TMN-10, l'éther laurylique de polyoxyéthylène 10 et l'éther tridécylique de polyoxyéthylène 10 peuvent généralement remplacer le TRITON™ X-100 dans les applications où l'invisibilité UV est importante. Ces détergents possèdent des fragments hydrophobes aliphatiques et n'absorbent donc pas de manière significative dans la région ultraviolette.

Bien que les polyoxyéthylènes présentent un avantage de coût significatif par rapport aux détergents synthétiques non ioniques tels que les alkylglycosides, ces derniers restent les détergents de choix dans de nombreuses applications pour deux raisons principales. Premièrement, ils sont homogènes en ce qui concerne leur composition et leur structure. Deuxièmement, plusieurs variantes d'alkylglycosides contenant différentes combinaisons de la chaîne hydrocarbonée et du groupe sucre polaire peuvent être facilement synthétisées sous des formes pures. De subtiles différences dans les propriétés physico-chimiques des glycosides d'alkyle portant diverses chaînes alkyle, attachées à un groupe de tête glucose, maltose ou saccharose, peuvent être exploitées pour la solubilisation sélective des protéines membranaires. dix

Détergents zwitterioniques

Les détergents zwitterioniques ont des caractéristiques de types à la fois ioniques et non ioniques. Comme les détergents non ioniques, les zwittergents ne possèdent pas de charge nette, ils manquent de conductivité et de mobilité électrophorétique, et ne se lient pas aux résines échangeuses d'ions. Cependant, comme les détergents ioniques, ils sont efficaces pour briser les interactions protéine-protéine. Les zwittergents à base de stéroïdes tels que CHAPS sont moins dénaturants que les détergents zwitterioniques à chaîne linéaire (par exemple, l'oxyde de dodécyldiméthyldiamine). 7

Sulfobétaïnes non détergentes

Les sulfobétaïnes non détergentes, les NDSB, sont des composés zwitterioniques. Comme les sulfobétaïnes détergentes (SB) - telles que les SB linéaires (par exemple, SB 3-16, SB 3-10, 3-12 et 3-14), 11 CHAPS 12 et les amidosulfobétaïnes (par exemple, N-alkylamidopropyl-N,Ndiméthylaminoalkyll- sulfonate) 13 – Les NDSB portent le groupe de tête hydrophile sulfobétaïne. Cependant, contrairement aux SB, les groupes hydrophobes dans les NDSB sont trop courts pour la formation de micelles, même à des concentrations aussi élevées que 1 M. Par conséquent, les NDSB peuvent être facilement éliminés par dialyse et ils peuvent facilement diffuser dans les matrices de chromatographie et les gels de polyacrylamide pour les applications électrophorétiques. .

Les NDSB ont d'abord été utilisés dans des expériences de focalisation isoélectrique natives pour filtrer les interactions électrostatiques sans augmenter la conductivité. 14 Depuis lors, ils ont trouvé une utilisation dans un large éventail d'applications, y compris la solubilisation et la cristallisation de protéines 14,15, ainsi que la renaturation et le repliement de protéines chimiquement et thermiquement dénaturées. 16 En raison de leurs groupes hydrophobes courts et de leur effet de filtrage de charge, les NDSB empêchent l'agrégation et entraînent des rendements plus élevés de protéines membranaires. De plus, les NDSB n'interfèrent pas avec les dosages enzymatiques impliquant des substrats chromogènes portant des groupes nitrophényle et ils n'inhibent pas les activités d'enzymes telles que la β-galactosidase et la phosphatase alcaline. 14 Il convient également de noter que NDSB-195, NDSB-211 et NDSB-221 n'absorbent pas à 280 nm, ils sont donc compatibles avec les procédures de purification des protéines dans lesquelles les concentrations de protéines sont surveillées en mesurant l'absorbance à cette longueur d'onde. 17


Est-il difficile de renaturer une protéine ? - La biologie

Il y a plusieurs questions importantes que le cristallographe doit se poser sur une protéine avant de commencer une expérience de cristallisation. Quel est le poids moléculaire de la protéine ? Dans quel tampon la protéine sera-t-elle stable ? La protéine restera-t-elle active si je la fais bouillir dans du HCl concentré ? Au début de la cristallographie, ces questions pouvaient être posées au biochimiste qui avait minutieusement caractérisé la protéine en détail pendant de nombreuses années avant les études structurelles. De nos jours, avec l'avènement des projets de génomique structurale, la séquence d'acides aminés peut être la seule information dont dispose un cristallographe. Dans cette section, nous explorons combien de ces questions importantes peuvent être répondues sur Internet étant donné uniquement la séquence d'acides aminés.

La séquence d'acides aminés de la protéinase K de Album Tritirachium

GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEF
EGRAQMVKTYYYSSRRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDN
GSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQ
SSGVMVAVAAGNNNADARNNYSPASEPSVCTVGASDRYDRRSSFSNYGSVL
DIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASAC
RYIADTANKGDLSNIPFGTVNLLAYNNYQA

Répondez aux questions ci-dessous en collant la séquence de la protéinase K sur le site Web ci-dessous.

Question Site Internet
Quel est le poids moléculaire de ma protéine ? Les protéines plus grosses ont souvent plusieurs domaines disquettes qui rendent la protéine difficile à cristalliser. Les protéines à domaine unique sont généralement inférieures à 30 kDa. http://ca.expasy.org/tools/protparam.html
Combien y a-t-il d'acides aminés dans la protéine ? Combien sont la méthionine ? Généralement, plus d'une méthionine pour 100 acides aminés assurera le succès d'une expérience de sélénomet MAD. http://ca.expasy.org/tools/protparam.html
Y a-t-il des résidus tryptophane dans la séquence protéique ? Les tryptophanes sont de bons points de référence pour attribuer une séquence aux cartes de densité électronique en raison de leur grande taille et de leur forme distinctive. Mais plus important encore, la présence de tryptophanes confère un coefficient d'extinction significatif à une longueur d'onde de 280 nm qui facilite la détermination de la concentration en protéines par spectrophotométrie. (Tyr, Phe et disulfures contribuent également un composant mineur au coefficient d'extinction, mais en l'absence de tryptophane, leur contribution peut ne pas être suffisante pour permettre une détermination spectrophotométrique précise de la concentration en protéines). http://ca.expasy.org/tools/protparam.html
Quel est le coefficient d'extinction à 280 nm ? Un nombre précieux pour déterminer la concentration en protéines par spectrophotométrie. Les dosages Biuret ou BioRad sont des méthodes alternatives de détermination de la concentration en protéines, mais ils prennent plus de temps. http://ca.expasy.org/tools/protparam.html
Y a-t-il des résidus de cystéine libres ? Les cystéines sont réactives avec le mercure et d'autres ions de métaux lourds de classe B. Leur présence suggère que le mercure pourrait être utilisé comme dérivé pour le phasage. Il faut également tenir compte de l'emplacement cellulaire de la protéine. Si elle est extracellulaire, les cystéines pourraient être oxydées dans une liaison disulfure, réduisant la réactivité de la cystéine envers les atomes lourds. http://ca.expasy.org/tools/protparam.html
Quel est le pI de ma protéine ? Le pI déterminera de quelle manière la protéine migrera dans un champ électrique dans un essai de décalage de bande sur gel natif pour les dérivés potentiels d'atomes lourds. De plus, si la protéine est insoluble lorsqu'elle est concentrée, il faut envisager d'utiliser un tampon plus éloigné du pI. http://ca.expasy.org/tools/protparam.html
Existe-t-il des homologues à ma protéine ? Quelles sont leurs fonctions ? Un homologue proche dans la PDB (mieux que 30% de similarité de séquence) permettra le phasage par remplacement moléculaire. En outre, la connaissance de la biochimie d'un homologue peut être utilisée pour combler les lacunes dans les connaissances sur la protéine en question si elle n'est pas bien étudiée. http://www.ncbi.nlm.nih.gov/BLAST/ (utiliser blastp)
Existe-t-il des ligands que je peux complexer avec ma protéine pour aider à stabiliser la flexibilité conformationnelle de la protéine ? Plus une protéine est rigide, plus elle risque de cristalliser. De plus, un complexe avec substrat ou analogue de substrat est intrinsèquement plus intéressant et révélateur scientifiquement. S'il existe de la littérature pour votre protéine, vous pouvez la rechercher par mot-clé sur PUBMED. S'il n'existe aucune littérature pour votre protéine, vous pouvez rechercher de la littérature sur l'homologue que vous avez découvert dans la recherche blast ci-dessus. http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Quelle est la prédiction de structure secondaire pour ma protéine ? Il est utile de connaître la prédiction de structure secondaire lorsque vous jugez la qualité de votre première carte expérimentale de densité électronique. Si la prédiction suggère toutes les hélices et que vous ne trouvez pas une seule hélice sur la carte, alors vous pouvez remettre en question la qualité de votre carte ? http://bioinf.cs.ucl.ac.uk/psipred/psiform.html
de nombreuses autres options répertoriées par le site Web expasy.
(2) Concentrer vos protéines

Les cristallographes sont LES experts de la concentration en protéines. Peu d'autres expériences en biochimie nécessitent des concentrations aussi élevées de protéine pure que les expériences de cristallisation. La cristallisation nécessite généralement une concentration de 10 mg/mL pour les protéines dans la plage de 10 à 30 kDa. Les protéines plus grosses ont tendance à nécessiter moins de concentration (2 à 5 mg/mL). Les protéines plus petites ont tendance à nécessiter une concentration plus élevée (20-50 mg/mL). Un kit est disponible pour vous aider à tester si votre protéine est à une concentration appropriée pour les premiers essais de cristallisation. Il contient plusieurs agents précipitants couramment utilisés en cristallisation. Si, lors de l'ajout de ces agents à 3 ul de votre protéine, vous constatez la formation de précipitations, il est alors probable que votre concentration en protéines soit appropriée pour les essais de cristallisation. Pour obtenir le kit de pré-écran Crystool (gratuit ?), envoyez un e-mail à Bernhard Rupp.

Je concentre généralement les protéines à l'aide d'un concentrateur Centricon d'Amicon. Le centricon est conçu pour utiliser la force centrifuge pour pousser le solvant à travers les pores d'une membrane, tandis que votre protéine est retenue à l'intérieur par exclusion de taille. Le centricon peut contenir jusqu'à 2,5 ml et se concentre jusqu'à un minimum d'environ 100 ul dans un rotor SS34. La concentration nécessite environ 2 heures à 5000 rpm.

Vérifiez TOUJOURS la concentration de la protéine avant d'utiliser un centricon. Une bonne récupération à partir d'un centricon n'est pas toujours assurée au début, vous voulez donc être en mesure de vérifier que vous obtenez la même quantité de protéines du centricon que vous y mettez. Une bonne récupération dépend du choix du seuil de poids moléculaire correct (MWCO ), et le tampon approprié : Il existe différents MWCO (3kDa, 10kDa, 30kDa) pour des protéines de différentes tailles. Plus le MWCO est grand, plus le processus de concentration est rapide. Veillez à choisir un MWCO nettement inférieur au poids moléculaire de votre protéine. Sinon, la protéine peut être piégée dans les pores de la membrane. C'est également une bonne idée d'inclure au moins 10 mM de NaCl pour empêcher la protéine de coller à la surface de la membrane. Si la force ionique est trop faible, les parties hydrophobes de la protéine se déposent sur la surface de la membrane, obstruant les pores et ralentissant le processus de concentration. Lorsque ce phénomène se produit, vous pouvez également réduire considérablement le rendement de récupération des protéines.

Atteindre une concentration de protéines adéquate tout en maintenant la solubilité peut être un problème délicat pour certaines protéines. Vous constaterez peut-être que votre protéine "s'huile" de la solution. (c'est-à-dire que vous trouvez une gelée transparente au fond du tube de récupération centricon.) Ou peut-être qu'elle précipite en un gâteau poudreux blanc. Ces choses se produisent parce que la protéine interagirait plutôt avec une autre molécule de protéine qu'avec des molécules de solvant. La solution à la "non-solution" réside généralement dans la recherche du bon pH du tampon ou de l'additif chimique. Éloignez davantage le pH du tampon du pi de la protéine afin d'augmenter la charge de la protéine et la favorabilité de son interaction avec le solvant. De plus, l'ajout de petites molécules organiques polaires telles que le glycérol, le saccharose, le méthylpentanediol ou le 1,6-hexanediol dissout souvent les huiles protéiques instantanément. Si vous savez que votre protéine utilise des ions métalliques ou se lie à un ligand, l'ajout de ces produits chimiques pourrait également améliorer la solubilité des protéines. Dans les cas très difficiles, vous pouvez utiliser un détergent doux tel que le bêta-octyl glucoside. Un moyen pratique de tester différents composés pour leur effet solubilisant sur la protéine est de prendre une goutte d'huile de protéine ou de précipiter sur une lamelle de verre et d'y ajouter un produit chimique tout en observant la goutte au microscope. Si l'huile ou le précipité se dissout, vous pouvez ajouter ce produit chimique à votre stock de protéines avant la concentration pour maintenir la solubilité.

(3) Explication de la méthode de cristallisation par diffusion de vapeur en gouttes suspendues

La technique de diffusion de vapeur en gouttes suspendues est la méthode la plus répandue pour la cristallisation des macromolécules. Le principe de la diffusion de vapeur est simple. Une goutte composée d'un mélange d'échantillon et de réactif est placée en équilibrage de vapeur avec un réservoir liquide de réactif. Typiquement, la goutte contient une concentration de réactif plus faible que le réservoir. Pour atteindre l'équilibre, la vapeur d'eau quitte la goutte et finit par se retrouver dans le réservoir. Au fur et à mesure que l'eau quitte la goutte, l'échantillon subit une augmentation de la sursaturation relative. La concentration de l'échantillon et du réactif augmente à mesure que l'eau quitte la goutte pour le réservoir. L'équilibre est atteint lorsque la concentration de réactif dans la goutte est approximativement la même que celle dans le réservoir.


Qu'est-ce qu'un gène ?

La définition d'un gène peut différer selon à qui vous demandez. Le gène mondial est littéralement devenu une icône culturelle de notre époque. Nos gènes peuvent-ils expliquer ce que c'est que d'être humain ? La définition d'un gène a changé avec le temps.

Figure : Une vue des gènes et de leurs produits : de la simplicité à la complexité

Les gènes eucaryotes contiennent des exons (régions codantes) et des introns (séquençages intermédiaires) qui sont transcrits pour produire un transcrit primaire. Dans un processus post-transcriptionnel, les introns sont épissés par le splicesome, pour produire un ARN messager, l'ARNm, qui est traduit en une séquence protéique. (Voir schéma ci-dessus).

Au cours des 100 dernières années, au fur et à mesure que notre compréhension de la biochimie a augmenté, la définition d'un gène a évolué de

  • la base des traits héréditaires
  • certaines régions des chromosomes
  • un segment d'un chromosome qui produit une enzyme
  • un segment d'un chromosome qui produit une protéine
  • un segment d'un chromosome qui produit un produit fonctionnel

La dernière définition était nécessaire car certains produits géniques qui ont une fonction (structurelle et catalytique) sont des molécules d'ARN. La dernière définition inclut également les régions régulatrices du chromosome impliquées dans le contrôle transcriptionnel. Snyder et Gerstein ont développé cinq critères qui peuvent être utilisés dans l'identification des gènes, ce qui est important car les génomes complets des organismes sont analysés pour les gènes.

  1. identification d'un cadre de lecture ouvert (ORF) - cela inclurait une série de codons délimités par des codons de départ et d'arrêt. Cela devient progressivement plus difficile à faire si le gène a un grand nombre d'exons intégrés dans de longs introns.
  2. specific DNA features within genes - these would include a bias towards certain codons found in genes or splice sites (to remove intron RNA)
  3. comparing putative gene sequences for homology with known genes from different organisms, but avoiding sequences that might be conserved regulatory regions.
  4. identification of RNA transcripts or expressed protein (which does not require DNA sequence analysis as the top three steps do) -
  5. inactivating (chemically or through specific mutagenesis) a gene product (RNA or protein).

New findings make it even more complicated to define a gene, especially if the transcripts of a "gene region" are studied. Cheng et al studied all transcripts from 10 different human chromosomes and 8 different cell lines. They found a large number of different transcripts, many of which overlapped. Splicing often occur between nonadjacent introns. Transcripts were found from both strands and were from regions containing introns and exons. Other studies found up to 5% of transcripts continued through the end of "gene" into other genes. 63% of the entire mouse genome, which is comprised of only 2% exons, is transcribed.


SUWA: A hyperstable artificial protein that does not denature in high temperatures above 100C

The Onbashira Matsuri is a festival where men climb on and slide down a mountain side on large timber logs, a holy tradition dating back 1,200 years. The lumber is then used to build the one of the main shrines of Japan, the Suwa Taisha. Credit: ©2012-2014 Suwa Tourism Association

Proteins denature, or "cook" in heat, irreversibly changing their structure, like how an egg boils or a slab of sirloin turns to steak. This prevents proteins from being used in applications where they would need to withstand heat. Scientists have had high expectations for proteins to be used in nanotechnology and synthetic biology. A new hyperstable artificial protein constructed at Shinshu University in collaboration with Princeton University hopes to make some of those aspirations possible with the successful development of SUWA (Super WA20), a nanobuilding block in the shape of a pillar, so-called in honor of the Onbashira Matsuri, also known as "the pillar" festival where men climb on and slide down a mountain side on large timber logs, a holy tradition dating back 1,200 years. The lumber is then used to build one of the main shrines of Japan, the Suwa Taisha. The hope is that these SUWA nano-pillars will go on to build things just as central to society.

  • A de novo protein SUWA (Super WA20) is significantly more stable than its predecessor WA20.
  • SUWA did not boil at 100 °C, while WA20 denatures at 75 °C. The denaturation midpoint temperature of SUWA protein was found to be 122 °C. This is an ultra-stabilized artificial protein.
  • The characteristic three-dimensional structure of the dimer with a bisecting U topology of SUWA was elucidated by X-ray crystallography.
  • Molecular dynamics simulation suggests that the stabilization of the center of the α-helices contributes to the structural stabilization and high heat resistance in SUWA.
  • Protein nanobuilding blocks using SUWA, nanoscale pillars "nano-onbashira" are expected to be applied to nanotechnology and synthetic biology research in the near future.

Proteins and self-assembling protein complexes perform functions inside the living body like nanomachines making them a key component in the complex phenomena of life. Artificial design of proteins with desired functions would have many applications in biopharmacy and provide chemical reactions with low environmental impact. This nanotechnology is in the scale of molecules, 1/1,000,000 of a millimeter, making them difficult to work with, but have many promising applications.

The ratio of denatured proteins with temperature. Credit: © 2020, American Chemical Society

A research group led by Ryoichi Arai of Shinshu University and Michael H. Hecht of Princeton University solved the crystal structure of the de novo protein WA20 in 2012. This current research builds upon the WA20 structure, to make the Super WA20—aka SUWA—recently explored in the paper published in the February issue of ACS Synthetic Biology, an American Chemical Society academic journal.

Associate Professor Ryoichi Arai of Shinshu University Interdisciplinary Cluster of Cutting Edge Research's Institute for Biomedical Sciences and Naoya Kimura, a graduate of the Faculty of Textile Science and Technology of Shinshu University were central figures behind this new development of SUWA, a hyperstable artificial protein.

The Onbashira Matsuri is a festival where men climb on and slide down a mountain side on large timber logs, a holy tradition dating back 1,200 years. The lumber is then used to build the one of the main shrines of Japan, the Suwa Taisha. Credit: ©2012-2014 Suwa Tourism Association

The naming of SUWA is derived from the location of the Onbashira Matsuri, which takes place in the Suwa region of Nagano Prefecture. Nagano is where Shinshu University holds its five campuses.


HSC Biology Concept 6: Antigens and Organ Transplants

Your organs have antigens on their surface. Your immune system recognises these as part of your body and doesn’t launch an immune response against them.

However, organs or parts of organs can be transplanted from the body of a donor into the body of a patient.

The donated organ will have surface antigens unique to the donor and so the patient’s body recognises these as foreign. The immune system will attack these foreign cells and try to destroy the donated organ.

The patient is given immune suppressants to stop the body from attacking the donated organ, but this leaves the patient more susceptible to actual pathogens that cause illness. The patient will have to remain on immune suppressants for the rest of their life.


Voir la vidéo: Lihaskasvu ja rasvanpoltto, osa 1: Kuinka nopeasti lihas kasvaa? (Décembre 2022).